Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Bcan protein

This Rat Bcan protein spans the amino acid sequence from region 658-786aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain-enriched hyaluronan-binding protein Short name, BEHAB

UniProt

P55068

Expression Region

658-786aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dnase1l3  ELISA Kit
EF018569 96 Tests

Rat Dnase1l3 ELISA Kit

Sign In for Pricing
View Details
Camel Paralemmin ELISA Kit
MBS088639-01 48 Well

Camel Paralemmin ELISA Kit

Sign In for Pricing
View Details
Camel Paralemmin ELISA Kit
MBS088639-02 96 Well

Camel Paralemmin ELISA Kit

Sign In for Pricing
View Details
Camel Paralemmin ELISA Kit
MBS088639-03 5x 96 Well

Camel Paralemmin ELISA Kit

Sign In for Pricing
View Details
Camel Paralemmin ELISA Kit
MBS088639-04 10x 96 Well

Camel Paralemmin ELISA Kit

Sign In for Pricing
View Details
Pig CD40 ligand ELISA Kit
MBS2886234-01 48 Well

Pig CD40 ligand ELISA Kit

Sign In for Pricing
View Details