Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PrgJ protein

This prgJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P41785

Expression Region

1-101aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Hemochromatosis Type 2/Uvenile-Uman Homolog ELISA Kit
MBS068900 Inquire

Duck Hemochromatosis Type 2/Uvenile-Uman Homolog ELISA Kit

Sign In for Pricing
View Details
Anti-eIF4E Mouse mAb
E2201136 100 µL

Anti-eIF4E Mouse mAb

Sign In for Pricing
View Details
Canine Dickkopf Related Protein 1 (DKK1) ELISA Kit
EIA05572Ca 1 Kit

Canine Dickkopf Related Protein 1 (DKK1) ELISA Kit

Sign In for Pricing
View Details
JNK1/3 Recombinant Antibody, PE-Cy7 Conjugated
bsm-62902R-PE-Cy7 100 µL

JNK1/3 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Lentiviral human EEF2K shRNA (UAS) - Lentiviral human EEF2K shRNA (UAS, iRFP) plasmid
GTR15340087 1 Vial

Lentiviral human EEF2K shRNA (UAS) - Lentiviral human EEF2K shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
YraN Antibody
orb836157 2 mg

YraN Antibody

Sign In for Pricing
View Details