Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PrgJ protein

This prgJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P41785

Expression Region

1-101aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin10 Mouse Gene Knockout Kit (CRISPR)
KN515526 1 Kit

Septin10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AtMTA Rabbit pAb
A18862 20 µL

AtMTA Rabbit pAb

Sign In for Pricing
View Details
Sorting Nexin 8 (SNX8) Antibody
abx433297 200 µL

Sorting Nexin 8 (SNX8) Antibody

Sign In for Pricing
View Details
Mouse TOM1L1 siRNA
abx937718-01 15 nmol

Mouse TOM1L1 siRNA

Sign In for Pricing
View Details
Mouse TOM1L1 siRNA
abx937718-02 30 nmol

Mouse TOM1L1 siRNA

Sign In for Pricing
View Details
Rabbit Polyclonal PIK3CA Antibody [PerCP]
NBP2-98814PCP 0.1 mL

Rabbit Polyclonal PIK3CA Antibody [PerCP]

Sign In for Pricing
View Details