Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRG2 protein

This Human PRG2 protein spans the amino acid sequence from region 17-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name (s) : Pregnancy-associated major basic protein

UniProt

P13727

Expression Region

17-104aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Short-chain Dehydrogenase/Reductase family 42E member 1 (SDR42E1) Mouse ELISA Kit
H0680 96 Tests

Short-chain Dehydrogenase/Reductase family 42E member 1 (SDR42E1) Mouse ELISA Kit

Sign In for Pricing
View Details
Anti-Human CD344/FZD4 Antibody (5017#), APC
FHJ80413 100 Tests

Anti-Human CD344/FZD4 Antibody (5017#), APC

Sign In for Pricing
View Details
Tacrolimus Hydrate
466781-01 1 mg

Tacrolimus Hydrate

Sign In for Pricing
View Details
Tacrolimus Hydrate
466781-02 10 mg

Tacrolimus Hydrate

Sign In for Pricing
View Details
Tacrolimus Hydrate
466781-03 50 mg

Tacrolimus Hydrate

Sign In for Pricing
View Details
Tacrolimus Hydrate
466781-04 100 mg

Tacrolimus Hydrate

Sign In for Pricing
View Details