Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sost protein

This Rat Sost protein spans the amino acid sequence from region 29-213aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q99P67

Expression Region

29-213aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Alpha-1-Antitrypsin (a1AT) ELISA Kit
orb2667226-01 48 Tests

Mouse Alpha-1-Antitrypsin (a1AT) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha-1-Antitrypsin (a1AT) ELISA Kit
orb2667226-02 96 Tests

Mouse Alpha-1-Antitrypsin (a1AT) ELISA Kit

Sign In for Pricing
View Details
Folinic Acid Calcium Salt discontinued. See F5810
450881-01 250 mg

Folinic Acid Calcium Salt discontinued. See F5810

Sign In for Pricing
View Details
Folinic Acid Calcium Salt discontinued. See F5810
450881-02 500 mg

Folinic Acid Calcium Salt discontinued. See F5810

Sign In for Pricing
View Details
ZNF256 Rabbit Polyclonal Antibody (FITC)
orb2115462 100 µL

ZNF256 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CCBP2 Rabbit Polyclonal Antibody (FITC)
orb187194 100 µL

CCBP2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details