Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL13 protein

This Human IL13 protein spans the amino acid sequence from region 25-146aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P35225

Expression Region

25-146aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse GPC3/Glypican 3 Protein, C-His
EME84602 100 μg

Recombinant Mouse GPC3/Glypican 3 Protein, C-His

Sign In for Pricing
View Details
ATAD3A polyclonal antibody
orb647232-01 50 μL

ATAD3A polyclonal antibody

Sign In for Pricing
View Details
ATAD3A polyclonal antibody
orb647232-02 100 µL

ATAD3A polyclonal antibody

Sign In for Pricing
View Details
ATAD3A polyclonal antibody
orb647232-03 200 µL

ATAD3A polyclonal antibody

Sign In for Pricing
View Details
Anti-ZBTB7A Antibody (R1G42)
RHB62002 100 μg

Anti-ZBTB7A Antibody (R1G42)

Sign In for Pricing
View Details
Recombinant Enterobacter sp. Histidine--tRNA ligase (hisS)
MBS1260976-01 0.02 mg (E-Coli)

Recombinant Enterobacter sp. Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details