Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FSHR protein

This Human FSHR protein spans the amino acid sequence from region 18-366aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Follitropin receptor

UniProt

P23945

Expression Region

18-366aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit
MBS167108-01 48 Well

Human Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit
MBS167108-02 96 Well

Human Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit
MBS167108-03 5x 96 Well

Human Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit
MBS167108-04 10x 96 Well

Human Transforming Growth Factor Beta Receptor II (TGFbR2) ELISA Kit

Sign In for Pricing
View Details
(Rac) -VU 6008667
M33096-01 1 g

(Rac) -VU 6008667

Sign In for Pricing
View Details
(Rac) -VU 6008667
M33096-02 500 mg

(Rac) -VU 6008667

Sign In for Pricing
View Details