Human TNFRSF18 protein
This Human TNFRSF18 protein spans the amino acid sequence from region 26-161aa. Purity: Greater than 92% as determined by SDS-PAGE.
Product Specifications
UniProt
Q9Y5U5
Expression Region
26-161aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 92% as determined by SDS-PAGE.
Bioactivity
1Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml.2Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay.
Form
Lyophilized powder
Molecular Weight
40.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6377262-01 0.1 mL
ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) APC
Sign In for Pricing
View Details MBS6377262-02 5x 0.1 mL
ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) APC
Sign In for Pricing
View Details