Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFSF18 protein

This Human TNFSF18 protein spans the amino acid sequence from region 72-199aa. Purity: Greater than 94% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9UNG2

Expression Region

72-199aa

Tag

N-terminal hFc-Flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 94% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml.2Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay.

Form

Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psca sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6210905 3x 1.0 µg

Psca sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Riok3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
39607116 3x 1.0 µg

Riok3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG Fc - Alexa Fluor 594
E38A3622 100 µL

Rabbit Anti-Human IgG Fc - Alexa Fluor 594

Sign In for Pricing
View Details
ATP6V0A4 (NM_130841) Human Tagged ORF Clone Lentiviral Particle
RC215672L3V 200 µL

ATP6V0A4 (NM_130841) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Rat SCO-spondin (Sspo) , partial
MBS1320921 Inquire

Recombinant Rat SCO-spondin (Sspo) , partial

Sign In for Pricing
View Details
Human Secretoglobin Family 2A, Member 2 (SCGB2A2) ELISA Kit
orb1663662-01 48 Tests

Human Secretoglobin Family 2A, Member 2 (SCGB2A2) ELISA Kit

Sign In for Pricing
View Details