Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fam3b protein

This Mouse Fam3b protein spans the amino acid sequence from region 30-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine-like protein 2-21 Pancreatic-derived factor Short name, PANDER

UniProt

Q9D309

Expression Region

30-235aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF-2 Antibody (YA442, Rabbit)
HY-P80671-01 20 µL

FGF-2 Antibody (YA442, Rabbit)

Sign In for Pricing
View Details
FGF-2 Antibody (YA442, Rabbit)
HY-P80671-02 50 μL

FGF-2 Antibody (YA442, Rabbit)

Sign In for Pricing
View Details
FGF-2 Antibody (YA442, Rabbit)
HY-P80671-03 100 µL

FGF-2 Antibody (YA442, Rabbit)

Sign In for Pricing
View Details
GAGE12I Recombinant Protein (Human)
RP012823 100 µg

GAGE12I Recombinant Protein (Human)

Sign In for Pricing
View Details
Mouse IRF1 ELISA Kit
E057038 1 Each

Mouse IRF1 ELISA Kit

Sign In for Pricing
View Details
Melanin
BA7415-50 50 mg

Melanin

Sign In for Pricing
View Details