Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fam3b protein

This Mouse Fam3b protein spans the amino acid sequence from region 30-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine-like protein 2-21 Pancreatic-derived factor Short name, PANDER

UniProt

Q9D309

Expression Region

30-235aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit GLO1/Glyoxalase I Antibody
orb1521359-01 10 µL

Rabbit GLO1/Glyoxalase I Antibody

Sign In for Pricing
View Details
Rabbit GLO1/Glyoxalase I Antibody
orb1521359-02 100 µL

Rabbit GLO1/Glyoxalase I Antibody

Sign In for Pricing
View Details
Lentiviral mouse F13b shRNA (UAS) - Lentiviral mouse F13b shRNA (UAS, GFP) (100)
GTR15257985 1 Vial

Lentiviral mouse F13b shRNA (UAS) - Lentiviral mouse F13b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CXCR7 (C-X-C Chemokine Receptor Type 7, CXC-R7, CXCR-7, Chemokine Orphan Receptor 1, G-protein Coupled Receptor 159, G-protein Coupled Receptor RDC1 Homolog, RDC-1, CMKOR1, GPR159, RDC1)
170359 50 µg

CXCR7 (C-X-C Chemokine Receptor Type 7, CXC-R7, CXCR-7, Chemokine Orphan Receptor 1, G-protein Coupled Receptor 159, G-protein Coupled Receptor RDC1 Homolog, RDC-1, CMKOR1, GPR159, RDC1)

Sign In for Pricing
View Details
Mouse Gm5082 qPCR Primer Pair
QM71090S 200 Tests

Mouse Gm5082 qPCR Primer Pair

Sign In for Pricing
View Details
Ambroxol Impurity 132
RM-A180532-01 10 mg

Ambroxol Impurity 132

Sign In for Pricing
View Details