Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit GHR protein

This Rabbit GHR protein spans the amino acid sequence from region 19-256aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Somatotropin receptor

UniProt

P19941

Expression Region

19-256aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CNGA1 qPCR Primer Pair
QH12165S 200 Tests

Human CNGA1 qPCR Primer Pair

Sign In for Pricing
View Details
EPGN Human, His
OM301075-01 5 µg

EPGN Human, His

Sign In for Pricing
View Details
EPGN Human, His
OM301075-02 20 µg

EPGN Human, His

Sign In for Pricing
View Details
EPGN Human, His
OM301075-03 1 mg

EPGN Human, His

Sign In for Pricing
View Details
Human OR2M3 Pre-designed siRNA Set B
SI011221B 1 Each

Human OR2M3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Csta1 Mouse shRNA Plasmid (Locus ID 209294)
TR506269 1 Kit

Csta1 Mouse shRNA Plasmid (Locus ID 209294)

Sign In for Pricing
View Details