Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit GHR protein

This Rabbit GHR protein spans the amino acid sequence from region 19-256aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Somatotropin receptor

UniProt

P19941

Expression Region

19-256aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm12169 3'UTR Lenti-reporter-Luc Vector
21754084 1.0 µg

Gm12169 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human Cd48 Antigen, CD48 Primacu ELISA Kit
MBS1612349-01 96 Well

Human Cd48 Antigen, CD48 Primacu ELISA Kit

Sign In for Pricing
View Details
Human Cd48 Antigen, CD48 Primacu ELISA Kit
MBS1612349-02 5x 96 Well

Human Cd48 Antigen, CD48 Primacu ELISA Kit

Sign In for Pricing
View Details
FAM177A1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2511439 100 µL

FAM177A1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
PRKACG discontinued
393344 200 µL

PRKACG discontinued

Sign In for Pricing
View Details
SOX5 Rabbit Polyclonal Antibody
orb2955228-01 50 µg

SOX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details