Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GYPB protein

This Human GYPB protein spans the amino acid sequence from region 20-91aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAS-3 SS-active sialoglycoprotein Sialoglycoprotein delta CD_antigen, CD235b

UniProt

P06028

Expression Region

20-91aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHST8 Antibody Blocking Peptide
orb1512814 500 µg

CHST8 Antibody Blocking Peptide

Sign In for Pricing
View Details
OSBP Recombinant Protein
OPCD00309-10UG 10 µg

OSBP Recombinant Protein

Sign In for Pricing
View Details
OTC Antibody
OAAN04011-50UL 50 µL

OTC Antibody

Sign In for Pricing
View Details
Lentiviral human STARD7 sgRNA gene knockout kit - Lentiviral human STARD7 sgRNA gene knockout kit (100)
GTR15386077 1 Vial

Lentiviral human STARD7 sgRNA gene knockout kit - Lentiviral human STARD7 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Mouse Monoclonal VHR/DUSP3 Antibody (9E6) [Janelia Fluor 549]
NBP2-59460JF549 0.1 mL

Mouse Monoclonal VHR/DUSP3 Antibody (9E6) [Janelia Fluor 549]

Sign In for Pricing
View Details
Echothiophate-d3 Iodide
448066-01 5 mg

Echothiophate-d3 Iodide

Sign In for Pricing
View Details