Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDC20 protein

This Human CDC20 protein spans the amino acid sequence from region 1-499aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P55CDC

UniProt

Q12834

Expression Region

1-499aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Innovative Grade US Origin Porcine Esophagus With Trachea Fresh in PBS
IGPCESOPPT4 1 Each

Innovative Grade US Origin Porcine Esophagus With Trachea Fresh in PBS

Sign In for Pricing
View Details
Canine Olfactory receptor 10T2 (OR10T2) ELISA Kit
MBS7213195-01 48 Well

Canine Olfactory receptor 10T2 (OR10T2) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 10T2 (OR10T2) ELISA Kit
MBS7213195-02 96 Well

Canine Olfactory receptor 10T2 (OR10T2) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 10T2 (OR10T2) ELISA Kit
MBS7213195-03 5x 96 Well

Canine Olfactory receptor 10T2 (OR10T2) ELISA Kit

Sign In for Pricing
View Details
Canine Olfactory receptor 10T2 (OR10T2) ELISA Kit
MBS7213195-04 10x 96 Well

Canine Olfactory receptor 10T2 (OR10T2) ELISA Kit

Sign In for Pricing
View Details
Regulated Power Supply
204020A 1 Each

Regulated Power Supply

Sign In for Pricing
View Details