Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD177 protein

This Human CD177 protein spans the amino acid sequence from region 22-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Human neutrophil alloantigen 2a; HNA-2a; NB1 glycoprotein; NB1 GP; Polycythemia rubra vera protein 1; PRV-1; CD177

UniProt

Q8N6Q3

Expression Region

22-321aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE1 (NM_138971) Human Over-expression Lysate
LY408446 100 µg

BACE1 (NM_138971) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Bromo-N- (1,1-dimethylethyl) -3-methylbenzenemethanamine
OR1084475-01 250 mg

4-Bromo-N- (1,1-dimethylethyl) -3-methylbenzenemethanamine

Sign In for Pricing
View Details
4-Bromo-N- (1,1-dimethylethyl) -3-methylbenzenemethanamine
OR1084475-02 500 mg

4-Bromo-N- (1,1-dimethylethyl) -3-methylbenzenemethanamine

Sign In for Pricing
View Details
Mdh Antibody
orb821195 2 mg

Mdh Antibody

Sign In for Pricing
View Details
Rat Ddt Pre-designed siRNA Set A
SI203641A 1 Each

Rat Ddt Pre-designed siRNA Set A

Sign In for Pricing
View Details
OTUD7B Antibody - middle region : HRP (ARP34594_P050-HRP)
ARP34594_P050-HRP 100 µL

OTUD7B Antibody - middle region : HRP (ARP34594_P050-HRP)

Sign In for Pricing
View Details