Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Herpesvirus 1 Glycoprotein C protein

This herpesvirus 1 Glycoprotein C protein spans the amino acid sequence from region 267-359aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UL44

UniProt

P28986

Expression Region

267-359aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSLTLQPHAVMEGQPFKATCTAAAYYPRNPVEFDWFEDDRQVFNPGQIDTQTHEHPDGFTTVSTVTSEAVGGQVPPRTFTCQMTWHRDSVTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Monkeypox Virus (MPXV) Envelope Protein E8L, His Tag
MOP2310 100 μg

Recombinant Monkeypox Virus (MPXV) Envelope Protein E8L, His Tag

Sign In for Pricing
View Details
Rabbit Polyclonal SPINK2 Antibody [Janelia Fluor 549]
NBP2-98568JF549 0.1 mL

Rabbit Polyclonal SPINK2 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Anti-Influenza A virus Cali Antibody, Dylight594 Conjugate
DZ41526-Dylight594 200 µL

Anti-Influenza A virus Cali Antibody, Dylight594 Conjugate

Sign In for Pricing
View Details
Bovine Caveolin 1 (CAV1) ELISA Kit
EIA05440Bo 1 Kit

Bovine Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal Histone H3.3 [p Ser31] Antibody (SR1217)
NBP3-21599-100ul 100 µL

Rabbit Monoclonal Histone H3.3 [p Ser31] Antibody (SR1217)

Sign In for Pricing
View Details
Anks1b (NM_181398) Mouse Tagged ORF Clone Lentiviral Particle
MR219884L3V 200 µL

Anks1b (NM_181398) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details