Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Herpesvirus 1 Glycoprotein C protein

This herpesvirus 1 Glycoprotein C protein spans the amino acid sequence from region 267-359aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UL44

UniProt

P28986

Expression Region

267-359aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSLTLQPHAVMEGQPFKATCTAAAYYPRNPVEFDWFEDDRQVFNPGQIDTQTHEHPDGFTTVSTVTSEAVGGQVPPRTFTCQMTWHRDSVTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemini Mixter Delicate Full Curved
0354-3 8 Inches

Gemini Mixter Delicate Full Curved

Sign In for Pricing
View Details
Sh3bp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
43668114 3x 1.0 µg

Sh3bp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ROCK2 Polyclonal Antibody
bs-1205R-01 20 µL

ROCK2 Polyclonal Antibody

Sign In for Pricing
View Details
ROCK2 Polyclonal Antibody
bs-1205R-02 100 µL

ROCK2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [HRP]
NBP2-97257H 0.1 mL

Rabbit Polyclonal Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [HRP]

Sign In for Pricing
View Details
3-Fluoropyridin-2-ylhydrazine
sc-356732 1 g

3-Fluoropyridin-2-ylhydrazine

Sign In for Pricing
View Details