Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERP3 protein

This DERP3 protein spans the amino acid sequence from region 30-261aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Der p III; Allergen: Der p 3

UniProt

P39675

Expression Region

30-261aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Dermatophagoides pteronyssinus (European house dust mite)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGEKALAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKRSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAT Rabbit Polyclonal Antibody (Cy5)
orb908936 100 µL

LAT Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Mouse IL-11 receptor alpha Recombinant
MBS553276-01 0.05 mg

Mouse IL-11 receptor alpha Recombinant

Sign In for Pricing
View Details
Mouse IL-11 receptor alpha Recombinant
MBS553276-02 0.2 mg

Mouse IL-11 receptor alpha Recombinant

Sign In for Pricing
View Details
Mouse IL-11 receptor alpha Recombinant
MBS553276-03 1 mg

Mouse IL-11 receptor alpha Recombinant

Sign In for Pricing
View Details
Mouse IL-11 receptor alpha Recombinant
MBS553276-04 5x 1 mg

Mouse IL-11 receptor alpha Recombinant

Sign In for Pricing
View Details
SLC7A5 Antibody
MBS8504571-01 0.1 mg

SLC7A5 Antibody

Sign In for Pricing
View Details