Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cry1Ia protein

This cry1Ia protein spans the amino acid sequence from region 97-180aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

81 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryII (a)

UniProt

Q45752

Expression Region

97-180aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bacillus thuringiensis subsp. Kurstaki

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKNQWEIFMEHVEEIINQKISTYARNKALTDLKGLGDALAVYHDSLESWVGNRNNTRARSVVKSQYIALELMFVQKLPSFAVSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Methoxybicyclo[3.3.1]nonan-3-amine hydrochloride
MRD34349-01 50 mg

1-Methoxybicyclo[3.3.1]nonan-3-amine hydrochloride

Sign In for Pricing
View Details
1-Methoxybicyclo[3.3.1]nonan-3-amine hydrochloride
MRD34349-02 0.5 g

1-Methoxybicyclo[3.3.1]nonan-3-amine hydrochloride

Sign In for Pricing
View Details
Anti-Zinc finger protein 786 ZNF786 Antibody
A16420 100 µL

Anti-Zinc finger protein 786 ZNF786 Antibody

Sign In for Pricing
View Details
Lentiviral human STPG1 shRNA (UAS) - Lentiviral human STPG1 shRNA (UAS, GFP) plasmid
GTR15153394 1 Vial

Lentiviral human STPG1 shRNA (UAS) - Lentiviral human STPG1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CXorf34 Rabbit Polyclonal Antibody (HRP)
orb2113724 100 µL

CXorf34 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Glu-AMS TEA
T201171-01 25 mg

Glu-AMS TEA

Sign In for Pricing
View Details