Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cry1Ia protein

This cry1Ia protein spans the amino acid sequence from region 97-180aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

81 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryII (a)

UniProt

Q45752

Expression Region

97-180aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bacillus thuringiensis subsp. Kurstaki

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKNQWEIFMEHVEEIINQKISTYARNKALTDLKGLGDALAVYHDSLESWVGNRNNTRARSVVKSQYIALELMFVQKLPSFAVSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD146 (Mucin 18, MUC18 Glycoprotein, Melanoma Associated Antigen A32, S-endo 1 Endothelial Associated Antigen, Melanoma Adhesion Molecule Mel-CM) (Biotin)
MBS6468227-01 0.1 mL

CD146 (Mucin 18, MUC18 Glycoprotein, Melanoma Associated Antigen A32, S-endo 1 Endothelial Associated Antigen, Melanoma Adhesion Molecule Mel-CM) (Biotin)

Sign In for Pricing
View Details
CD146 (Mucin 18, MUC18 Glycoprotein, Melanoma Associated Antigen A32, S-endo 1 Endothelial Associated Antigen, Melanoma Adhesion Molecule Mel-CM) (Biotin)
MBS6468227-02 5x 0.1 mL

CD146 (Mucin 18, MUC18 Glycoprotein, Melanoma Associated Antigen A32, S-endo 1 Endothelial Associated Antigen, Melanoma Adhesion Molecule Mel-CM) (Biotin)

Sign In for Pricing
View Details
RUNX3 Antibody, HRP conjugated
CSB-PA020595LB01HU-01 50 µg

RUNX3 Antibody, HRP conjugated

Sign In for Pricing
View Details
RUNX3 Antibody, HRP conjugated
CSB-PA020595LB01HU-02 100 µg

RUNX3 Antibody, HRP conjugated

Sign In for Pricing
View Details
Ethyl 2,3,4-tri-O-acetyl-β-D-glucuronide methyl ester
orb2941848-01 100 mg

Ethyl 2,3,4-tri-O-acetyl-β-D-glucuronide methyl ester

Sign In for Pricing
View Details
Ethyl 2,3,4-tri-O-acetyl-β-D-glucuronide methyl ester
orb2941848-02 50 mg

Ethyl 2,3,4-tri-O-acetyl-β-D-glucuronide methyl ester

Sign In for Pricing
View Details