Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cry1Ia protein

This cry1Ia protein spans the amino acid sequence from region 97-180aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

81 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryII (a)

UniProt

Q45752

Expression Region

97-180aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bacillus thuringiensis subsp. Kurstaki

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKNQWEIFMEHVEEIINQKISTYARNKALTDLKGLGDALAVYHDSLESWVGNRNNTRARSVVKSQYIALELMFVQKLPSFAVSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Stromal Cell Derived Factor 1alpha ELISA Kit
MBS012241-01 48 Well

Rat Stromal Cell Derived Factor 1alpha ELISA Kit

Sign In for Pricing
View Details
Rat Stromal Cell Derived Factor 1alpha ELISA Kit
MBS012241-02 96 Well

Rat Stromal Cell Derived Factor 1alpha ELISA Kit

Sign In for Pricing
View Details
Rat Stromal Cell Derived Factor 1alpha ELISA Kit
MBS012241-03 5x 96 Well

Rat Stromal Cell Derived Factor 1alpha ELISA Kit

Sign In for Pricing
View Details
Rat Stromal Cell Derived Factor 1alpha ELISA Kit
MBS012241-04 10x 96 Well

Rat Stromal Cell Derived Factor 1alpha ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Atp6v1g2 shRNA (UAS) - Lentiviral mouse Atp6v1g2 shRNA (UAS) plasmid
GTR15168631 1 Vial

Lentiviral mouse Atp6v1g2 shRNA (UAS) - Lentiviral mouse Atp6v1g2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rat tPA Active Recombinant 1mg
IRSTPAARC1MG 1 mg

Rat tPA Active Recombinant 1mg

Sign In for Pricing
View Details