Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERP3 protein

This DERP3 protein spans the amino acid sequence from region 19-261aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Der p III; Allergen: Der p 3

UniProt

P39675

Expression Region

19-261aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Dermatophagoides pteronyssinus (European house dust mite)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPILPASPNATIVGGEKALAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKRSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANK2 Protein Vector (Human) (pPB-C-His)
PV062161 500 ng

ANK2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
GSTZ1 Peptide
orb2014731 100 µg

GSTZ1 Peptide

Sign In for Pricing
View Details
CABIN1 Protein Vector (Human) (pPM-C-His)
PV067080 500 ng

CABIN1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human IgG Rabbit pAb
orb2714764-01 50 µL

Human IgG Rabbit pAb

Sign In for Pricing
View Details
Human IgG Rabbit pAb
orb2714764-02 100 µL

Human IgG Rabbit pAb

Sign In for Pricing
View Details
Lisinopril EP Impurity I
IL180422-01 2 mg

Lisinopril EP Impurity I

Sign In for Pricing
View Details