Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MUC5B protein

This Human MUC5B protein spans the amino acid sequence from region 4186-4295aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MUC-5B; Cervical mucin; High molecular weight salivary mucin MG1; Mucin-5 subtype B, tracheobronchial; Sublingual gland mucin

UniProt

Q9HC84

Expression Region

4186-4295aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Glyceric acid (sodium)
HY-113377A-01 5 mg

L-Glyceric acid (sodium)

Sign In for Pricing
View Details
L-Glyceric acid (sodium)
HY-113377A-02 10 mg

L-Glyceric acid (sodium)

Sign In for Pricing
View Details
Monkey Neuronal Pentraxin II ELISA Kit
MBS069854-01 48 Well

Monkey Neuronal Pentraxin II ELISA Kit

Sign In for Pricing
View Details
Monkey Neuronal Pentraxin II ELISA Kit
MBS069854-02 96 Well

Monkey Neuronal Pentraxin II ELISA Kit

Sign In for Pricing
View Details
Monkey Neuronal Pentraxin II ELISA Kit
MBS069854-03 5x 96 Well

Monkey Neuronal Pentraxin II ELISA Kit

Sign In for Pricing
View Details
Monkey Neuronal Pentraxin II ELISA Kit
MBS069854-04 10x 96 Well

Monkey Neuronal Pentraxin II ELISA Kit

Sign In for Pricing
View Details