Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sirt5 protein

This Mouse Sirt5 protein spans the amino acid sequence from region 37-310aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Regulatory protein SIR2 homolog 5 SIR2-like protein 5

UniProt

Q8K2C6

Expression Region

37-310aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAMBP Rabbit pAb, BF647 conjugated
orb2892444 100 µL

STAMBP Rabbit pAb, BF647 conjugated

Sign In for Pricing
View Details
PPOX Antibody, Biotin conjugated
CSB-PA018502LD01HU-01 50 µg

PPOX Antibody, Biotin conjugated

Sign In for Pricing
View Details
PPOX Antibody, Biotin conjugated
CSB-PA018502LD01HU-02 100 µg

PPOX Antibody, Biotin conjugated

Sign In for Pricing
View Details
3- (4-Aminophenyl) -1,2,4-oxadiazol-5 (2H) -one
OR1064535-01 100 mg

3- (4-Aminophenyl) -1,2,4-oxadiazol-5 (2H) -one

Sign In for Pricing
View Details
3- (4-Aminophenyl) -1,2,4-oxadiazol-5 (2H) -one
OR1064535-02 250 mg

3- (4-Aminophenyl) -1,2,4-oxadiazol-5 (2H) -one

Sign In for Pricing
View Details
Lentiviral human JADE1 shRNA (UAS) - Lentiviral human JADE1 shRNA (UAS) plasmid
GTR15343078 1 Vial

Lentiviral human JADE1 shRNA (UAS) - Lentiviral human JADE1 shRNA (UAS) plasmid

Sign In for Pricing
View Details