Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASAH2 protein

This Human ASAH2 protein spans the amino acid sequence from region 610-780aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-CDase; NCDase; Acylsphingosine deacylase 2; BCDase; LCDase; hCD; N-acylsphingosine amidohydrolase 2; Non-lysosomal ceramidase

UniProt

Q9NR71

Expression Region

610-780aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Thioguanosine-5'-O-monophosphate sodium salt
NT11483-01 1 mg

6-Thioguanosine-5'-O-monophosphate sodium salt

Sign In for Pricing
View Details
6-Thioguanosine-5'-O-monophosphate sodium salt
NT11483-02 2 mg

6-Thioguanosine-5'-O-monophosphate sodium salt

Sign In for Pricing
View Details
6-Thioguanosine-5'-O-monophosphate sodium salt
NT11483-03 5 mg

6-Thioguanosine-5'-O-monophosphate sodium salt

Sign In for Pricing
View Details
6-Thioguanosine-5'-O-monophosphate sodium salt
NT11483-04 10 mg

6-Thioguanosine-5'-O-monophosphate sodium salt

Sign In for Pricing
View Details
6-Thioguanosine-5'-O-monophosphate sodium salt
NT11483-05 25 mg

6-Thioguanosine-5'-O-monophosphate sodium salt

Sign In for Pricing
View Details
VEGFB Antibody - middle region : HRP (ARP58975_P050-HRP)
ARP58975_P050-HRP 100 µL

VEGFB Antibody - middle region : HRP (ARP58975_P050-HRP)

Sign In for Pricing
View Details