Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASAH2 protein

This Human ASAH2 protein spans the amino acid sequence from region 610-780aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-CDase; NCDase; Acylsphingosine deacylase 2; BCDase; LCDase; hCD; N-acylsphingosine amidohydrolase 2; Non-lysosomal ceramidase

UniProt

Q9NR71

Expression Region

610-780aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM3-set siRNA/shRNA/RNAi Lentivector (Human)
36513091 4x 500 ng

PGM3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
PARPBP Antibody - C-terminal region : HRP (ARP68106_P050-HRP)
ARP68106_P050-HRP 100 µL

PARPBP Antibody - C-terminal region : HRP (ARP68106_P050-HRP)

Sign In for Pricing
View Details
PEAK1 Antibody
A68839-100UG 100 µg

PEAK1 Antibody

Sign In for Pricing
View Details
ZNF622 Antibody Blocking peptide
orb1451471 500 µg

ZNF622 Antibody Blocking peptide

Sign In for Pricing
View Details
Human UAP1L1 Knockout A549 cell line
GTR15421199 1 Vial

Human UAP1L1 Knockout A549 cell line

Sign In for Pricing
View Details
Igsf10 3'UTR Luciferase Stable Cell Line
TU109981 1.0 mL

Igsf10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details