Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTHRC1 protein

This Human CTHRC1 protein spans the amino acid sequence from region 31-243aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96CG8

Expression Region

31-243aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0A2 Protein Vector (Mouse) (pPB-N-His)
PV157407 500 ng

ATP6V0A2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
GIPC2 Antibody
E30AC858 100 µL

GIPC2 Antibody

Sign In for Pricing
View Details
CAMKK2 (NM_172226) Human Recombinant Protein
TP303468L 1 mg

CAMKK2 (NM_172226) Human Recombinant Protein

Sign In for Pricing
View Details
USP Sol. Resorcinol TS
USP5405 500 mL

USP Sol. Resorcinol TS

Sign In for Pricing
View Details
Vsx2 Mouse Pre-designed siRNA Set A
HY-RS19973 1 Set

Vsx2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human DPY19L2P2 qPCR Primer Pair
QH74205S 200 Tests

Human DPY19L2P2 qPCR Primer Pair

Sign In for Pricing
View Details