Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCN1A protein

This Human SCN1A protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein brain I subunit alpha; Sodium channel protein type I subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.1

UniProt

P35498

Expression Region

1-128aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLDA2 Recombinant Protein (Human)
OPCA04874-1MG 1 mg

PHLDA2 Recombinant Protein (Human)

Sign In for Pricing
View Details
FAM134B Protein Vector (Mouse) (pPB-C-His)
PV177290 500 ng

FAM134B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Tom1l2 Rat siRNA Oligo Duplex (Locus ID 360537)
SR504342 1 Kit

Tom1l2 Rat siRNA Oligo Duplex (Locus ID 360537)

Sign In for Pricing
View Details
Anti-IL-6 antibody (DMC419); IgG1 Chimeric mAb
MBS1880294-01 0.01 mg

Anti-IL-6 antibody (DMC419); IgG1 Chimeric mAb

Sign In for Pricing
View Details
Anti-IL-6 antibody (DMC419); IgG1 Chimeric mAb
MBS1880294-02 0.1 mg

Anti-IL-6 antibody (DMC419); IgG1 Chimeric mAb

Sign In for Pricing
View Details
Anti-IL-6 antibody (DMC419); IgG1 Chimeric mAb
MBS1880294-03 0.5 mg

Anti-IL-6 antibody (DMC419); IgG1 Chimeric mAb

Sign In for Pricing
View Details