Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CYTL1 protein

This Human CYTL1 protein spans the amino acid sequence from region 23-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein C17

UniProt

Q9NRR1

Expression Region

23-136aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl10 Recombinant Rabbit monoclonal Antibody
HA751468 100 µL

Bcl10 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD4 Recombinant Rabbit multiclonal Antibody
HA723511 100 µL

CD4 Recombinant Rabbit multiclonal Antibody

Sign In for Pricing
View Details
Human KIAA1755 activation kit by CRISPRa
GA113889 1 Kit

Human KIAA1755 activation kit by CRISPRa

Sign In for Pricing
View Details
DKC1 (NM_001142463) Human Over-expression Lysate
LY428109 100 µg

DKC1 (NM_001142463) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808962 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
TUBB4B Human Gene Knockout Kit (CRISPR)
KN206339RB 1 Kit

TUBB4B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details