Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FolA protein

This folA protein spans the amino acid sequence from region 1-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DHFR

UniProt

P0C0P1

Expression Region

1-161aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTLSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLFEAMIDQVDDMYITVIDGKFQGDTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM128 activation kit by CRISPRa
GA113827 1 Kit

Human TMEM128 activation kit by CRISPRa

Sign In for Pricing
View Details
TGF beta Receptor II (TGFBR2) (NM_003242) Human Over-expression Lysate
LY401116 100 µg

TGF beta Receptor II (TGFBR2) (NM_003242) Human Over-expression Lysate

Sign In for Pricing
View Details
OS9 Polyclonal Antibody
E-AB-90389-01 60 µL

OS9 Polyclonal Antibody

Sign In for Pricing
View Details
OS9 Polyclonal Antibody
E-AB-90389-02 120 µL

OS9 Polyclonal Antibody

Sign In for Pricing
View Details
OS9 Polyclonal Antibody
E-AB-90389-03 200 µL

OS9 Polyclonal Antibody

Sign In for Pricing
View Details
CD252 (TNFSF4) (NM_003326) Human Over-expression Lysate
LC401143 20 µg

CD252 (TNFSF4) (NM_003326) Human Over-expression Lysate

Sign In for Pricing
View Details