Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-G protein

This Human HLA-G protein spans the amino acid sequence from region 25-308aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA G antigen; MHC class I antigen G

UniProt

P17693

Expression Region

25-308aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SNAP91 shRNA (UAS) - Lentiviral human SNAP91 shRNA (UAS, iRFP) plasmid
GTR15080584 1 Vial

Lentiviral human SNAP91 shRNA (UAS) - Lentiviral human SNAP91 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Dscaml1 shRNA (UAS) - Lentiviral mouse Dscaml1 shRNA (UAS, GFP) (100)
GTR15258105 1 Vial

Lentiviral mouse Dscaml1 shRNA (UAS) - Lentiviral mouse Dscaml1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Leucomalachite Green
90027147-5g 5 g

Leucomalachite Green

Sign In for Pricing
View Details
NIM1K (NM_153361) Human Recombinant Protein
PROTQ8IY84 20 µg

NIM1K (NM_153361) Human Recombinant Protein

Sign In for Pricing
View Details
FECH (Ferrochelatase (Protoporphyria), EPP, FCE) (MaxLight 490)
246058-ML490 100 µL

FECH (Ferrochelatase (Protoporphyria), EPP, FCE) (MaxLight 490)

Sign In for Pricing
View Details
Human SNAP47 (AAH18760.2) VersaClone cDNA
RDC3579 10 µg

Human SNAP47 (AAH18760.2) VersaClone cDNA

Sign In for Pricing
View Details