Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DODA protein

This DODA protein spans the amino acid sequence from region 1-228aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P87064

Expression Region

1-228aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Amanita muscaria (Fly agaric)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVPSFVVYSSWVNGRQRYIRQAFASILFYIIRDTTLSFPSHTTMSTKPETDLQTVLDSEIKEWHFHIYFHQNNAAEHQAALELRDAVLRLRQDGAFVAVPLFRVNMDPMGPHPVGSYEIWVPSETFASVFSYLCMNRGRLSILVHPLTREELRDHEIRNAWIGPSFPLNLANLPIKSDEIPLQYPSLKLGYSSTAHKMSLEERRKLGDDIEAVLRGEKEAARAPHRDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAN12 CRISPR All-in-one AAV vector set (with saCas9)(Human)
48218151 3x 1.0 µg DNA

TRNAN12 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
2-Bromo-4-methoxypyrimidine-d3
415920-01 10 mg

2-Bromo-4-methoxypyrimidine-d3

Sign In for Pricing
View Details
2-Bromo-4-methoxypyrimidine-d3
415920-02 100 mg

2-Bromo-4-methoxypyrimidine-d3

Sign In for Pricing
View Details
1-Cyclobutyl-4- (piperidine-4-carbonyl) piperazine
OR310942 500 mg

1-Cyclobutyl-4- (piperidine-4-carbonyl) piperazine

Sign In for Pricing
View Details
PHTF1 Protein Lysate (Human) with C-Ha Tag
36616031 100 µg

PHTF1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Scrapie-Responsive Protein 1, Recombinant, Human, aa21-98, His-Tag (SCRG1)
518100-01 20 µg

Scrapie-Responsive Protein 1, Recombinant, Human, aa21-98, His-Tag (SCRG1)

Sign In for Pricing
View Details