Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DODA protein

This DODA protein spans the amino acid sequence from region 1-228aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P87064

Expression Region

1-228aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Amanita muscaria (Fly agaric)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVPSFVVYSSWVNGRQRYIRQAFASILFYIIRDTTLSFPSHTTMSTKPETDLQTVLDSEIKEWHFHIYFHQNNAAEHQAALELRDAVLRLRQDGAFVAVPLFRVNMDPMGPHPVGSYEIWVPSETFASVFSYLCMNRGRLSILVHPLTREELRDHEIRNAWIGPSFPLNLANLPIKSDEIPLQYPSLKLGYSSTAHKMSLEERRKLGDDIEAVLRGEKEAARAPHRDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlamydia pneumoniae (TWAR Strain)
370353 1 mg

Chlamydia pneumoniae (TWAR Strain)

Sign In for Pricing
View Details
HECTD3 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb930068 100 µL

HECTD3 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Bacillus Cereus Real Time PCR Kit
PDHS-BR010 25 Tests

Bacillus Cereus Real Time PCR Kit

Sign In for Pricing
View Details
Adamts2 Rat shRNA Plasmid (Locus ID 287899)
TL709063 1 Kit

Adamts2 Rat shRNA Plasmid (Locus ID 287899)

Sign In for Pricing
View Details
Human CMC2 knockout cell line
ABC-KH3272 1 Vial

Human CMC2 knockout cell line

Sign In for Pricing
View Details
Active Asporin (ASPN)
MBS2105172-01 0.01 mg

Active Asporin (ASPN)

Sign In for Pricing
View Details