Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guinea pig IL23A protein

This Guinea pig IL23A protein spans the amino acid sequence from region 20-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; Interleukin-23 subunit p19; IL-23p19

UniProt

Q6LA37

Expression Region

20-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Cavia porcellus (Guinea pig)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYRENE-4,5-QUINONE
TRC-P841323-25MG 25 mg

PYRENE-4,5-QUINONE

Sign In for Pricing
View Details
RBM12 (Center) Rabbit Polyclonal Antibody
AP53604PU-N 400 µL

RBM12 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MCEMP1 Antibody
KC-29736-01 50 μL

MCEMP1 Antibody

Sign In for Pricing
View Details
MCEMP1 Antibody
KC-29736-02 100 µL

MCEMP1 Antibody

Sign In for Pricing
View Details
MCEMP1 Antibody
KC-29736-03 1 mL

MCEMP1 Antibody

Sign In for Pricing
View Details
Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF488A conjugate, 0.1mg/mL
BNC882829-500 1x 500 µL

Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details