Adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein protein
This adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein protein spans the amino acid sequence from region 18-123aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
E3-19K E3gp 19 kDa Short name: E19 GP19K
UniProt
P68978
Expression Region
18-123aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AKKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPGDTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQKCLENTG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040994-100 1x 100 µL
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040012-500 1x 500 µL
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470012-100 1x 100 µL
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 