Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli FimF41a protein

This E. coli FimF41a protein spans the amino acid sequence from region 23-277aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adhesin F41

UniProt

P11900

Expression Region

23-277aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADWTEGQPGDIIIGGEITSPSVKWLWKTGEGLSSFSNTTNEIVKRKLNISVPTDELFLAAKMSDGIKGVFVGNTLIPKIEMASYDGSVITPSFTSNTAMDIAVKVKNSGDNTELGTLSVPLSFGAAVATIFDGDTTDSAVAHIIGGSAGTVFEGLVNPGRFTDQNIAYKWNGLSKAEMAGYVEKLMPGQSASTSYSGFHNWDDLSHSNYTSANKASYLSYGSGVSAGSTLVMNLNKDVAGRLEWVAPVTITVIYS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lipoprotein-associated phospholipase A2 (Lp-PLA2) ELISA Kit
RK07376 96 Tests

Mouse Lipoprotein-associated phospholipase A2 (Lp-PLA2) ELISA Kit

Sign In for Pricing
View Details
THEMIS Antibody (C-term)
orb29150-01 50 µL

THEMIS Antibody (C-term)

Sign In for Pricing
View Details
THEMIS Antibody (C-term)
orb29150-02 100 µL

THEMIS Antibody (C-term)

Sign In for Pricing
View Details
RFP (Puro), Concentrated Lentivirus
LVP309-PBS 1x 10^8 IFU/mL - 200 μL

RFP (Puro), Concentrated Lentivirus

Sign In for Pricing
View Details
Loganic acid
C14038 1 mg

Loganic acid

Sign In for Pricing
View Details
TTLL11 3'UTR GFP Stable Cell Line
TU077447 1.0 mL

TTLL11 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details