Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Influenza A virus Matrix protein 1 protein

This Influenza A virus Matrix protein 1 protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proton channel protein M2

UniProt

A0A2R3YRM7

Expression Region

1-97aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Influenza A virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLLTEVETPTRSGWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC9 activation kit by CRISPRa
GA108747 1 Kit

Human CCDC9 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant RELB Antibody
RC-7010-01 50 μL

Recombinant RELB Antibody

Sign In for Pricing
View Details
Recombinant RELB Antibody
RC-7010-02 100 µL

Recombinant RELB Antibody

Sign In for Pricing
View Details
Recombinant RELB Antibody
RC-7010-03 1 mL

Recombinant RELB Antibody

Sign In for Pricing
View Details
CD66 (CEA) (CEA31), Biotin conjugate, 0.1mg/mL
BNCB0670-100 1x 100 µL

CD66 (CEA) (CEA31), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details