Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human coronavirus NL63 Envelope small membrane protein

This Human coronavirus NL63 Envelope small membrane protein spans the amino acid sequence from region 1-77aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name: E protein Short name: sM protein

UniProt

Q6Q1S0

Expression Region

1-77aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Human coronavirus NL63 (HCoV-NL63)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFLRLIDDNGIVLNSILWLLVMIFFFVLAMTFIKLIQLCFTCHYFFSRTLYQPVYKIFLAYQDYMQIAPVPAEVLNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK3 Blocking Peptide
MBS9614971-01 1 mg

MAPK3 Blocking Peptide

Sign In for Pricing
View Details
MAPK3 Blocking Peptide
MBS9614971-02 5x 1 mg

MAPK3 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit a (atpB)
MBS7009004-01 0.02 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit a (atpB)
MBS7009004-02 0.1 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit a (atpB)
MBS7009004-03 5x 0.1 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
CD68 Mouse Monoclonal Antibody [Clone ID: KP1]
E45M17663 100 µg

CD68 Mouse Monoclonal Antibody [Clone ID: KP1]

Sign In for Pricing
View Details