Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CYTL1 protein

This Human CYTL1 protein spans the amino acid sequence from region 23-136aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein C17

UniProt

Q9NRR1

Expression Region

23-136aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCS Polyclonal Antibody
bs-3896R 100 µL

CCS Polyclonal Antibody

Sign In for Pricing
View Details
Arachidonic acid
RM4044-100MG 1 unit

Arachidonic acid

Sign In for Pricing
View Details
Lentiviral human BORCS5 shRNA (UAS) - Lentiviral human BORCS5 shRNA (UAS, GFP) (25)
GTR15321623 1 Vial

Lentiviral human BORCS5 shRNA (UAS) - Lentiviral human BORCS5 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
RN5S195 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV743953 1.0 µg DNA

RN5S195 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human DYNC1I2 Protein - (Dry Ice)
H00001781-P02-25ug 25 µg

Recombinant Human DYNC1I2 Protein - (Dry Ice)

Sign In for Pricing
View Details
Bavachinin
M18196-01 1 g

Bavachinin

Sign In for Pricing
View Details