Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Firefly ITP protein

This Firefly ITP protein spans the amino acid sequence from region 33-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9W151

Expression Region

33-119aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNFFDLECKGIFNKTMFFRLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGECLKVLLIPEEEISNLQHFLRVVNGSPISFNMGPQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
43523124 3x 1.0µg DNA

SETD3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
MED16 AAV Vector (Mouse) (CMV)
28300105 1 µg

MED16 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Ku70 Blocking Peptide
MBS9614788-01 1 mg

Ku70 Blocking Peptide

Sign In for Pricing
View Details
Ku70 Blocking Peptide
MBS9614788-02 5x 1 mg

Ku70 Blocking Peptide

Sign In for Pricing
View Details
P63 Mouse mAb
E47M33422 100 µL

P63 Mouse mAb

Sign In for Pricing
View Details
Zfp780b AAV siRNA Pooled Vector
51128164 1.0 µg

Zfp780b AAV siRNA Pooled Vector

Sign In for Pricing
View Details