Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Firefly ITP protein

This Firefly ITP protein spans the amino acid sequence from region 33-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9W151

Expression Region

33-119aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNFFDLECKGIFNKTMFFRLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGECLKVLLIPEEEISNLQHFLRVVNGSPISFNMGPQT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FFAR3, CT (FFAR3, GPR41, Free fatty acid receptor 3, G-protein coupled receptor 41)
035608 200 µL

FFAR3, CT (FFAR3, GPR41, Free fatty acid receptor 3, G-protein coupled receptor 41)

Sign In for Pricing
View Details
GNMT 3'UTR Luciferase Stable Cell Line
TU009014 1.0 mL

GNMT 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human OSBPL10 Protein
BP3359-50ug 50 µg

Recombinant Human OSBPL10 Protein

Sign In for Pricing
View Details
VOC Std 16 Comp Mix 2000ug/mL in MeOH - 1ML
REVOC012 1 mL

VOC Std 16 Comp Mix 2000ug/mL in MeOH - 1ML

Sign In for Pricing
View Details
DAB2IP Antibody
MBS9411254-01 0.1 mL

DAB2IP Antibody

Sign In for Pricing
View Details
DAB2IP Antibody
MBS9411254-02 5x 0.1 mL

DAB2IP Antibody

Sign In for Pricing
View Details