Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SMOC1 protein

This Human SMOC1 protein spans the amino acid sequence from region 277-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted modular calcium-binding protein 1

UniProt

Q9H4F8

Expression Region

277-382aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 Recombinant Rabbit mAb, RBITC conjugated
orb2331988 100 µL

CD99 Recombinant Rabbit mAb, RBITC conjugated

Sign In for Pricing
View Details
MRRF CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
30609154 3x 1.0 µg DNA

MRRF CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
C4orf47 Human shRNA Plasmid Kit (Locus ID 441054)
TL321169 1 Kit

C4orf47 Human shRNA Plasmid Kit (Locus ID 441054)

Sign In for Pricing
View Details
Mouse SLC6A4 shRNA Plasmid
abx970944-01 150 µg

Mouse SLC6A4 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SLC6A4 shRNA Plasmid
abx970944-02 300 µg

Mouse SLC6A4 shRNA Plasmid

Sign In for Pricing
View Details
Mouse pre-microRNA Expression Construct mir-29a
MMIR-29a-PA-1 Bacterial Streak

Mouse pre-microRNA Expression Construct mir-29a

Sign In for Pricing
View Details