Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DRD2 protein

This Human DRD2 protein spans the amino acid sequence from region 214-373aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dopamine D2 receptor

UniProt

P14416

Expression Region

214-373aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SATB1 Rabbit mAb Antibody
orb1951930-01 50 µL

SATB1 Rabbit mAb Antibody

Sign In for Pricing
View Details
SATB1 Rabbit mAb Antibody
orb1951930-02 100 µL

SATB1 Rabbit mAb Antibody

Sign In for Pricing
View Details
Boc-L-3-Thienylalanine- DCHA
CSB-DT3289 1 g

Boc-L-3-Thienylalanine- DCHA

Sign In for Pricing
View Details
R-Phycoerythrin (HRP)
P4079-06B 1 mg

R-Phycoerythrin (HRP)

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar A Deubiquitinase and deneddylase Dub1 (cdu1)
orb2925046-01 20 µg

Recombinant Chlamydia trachomatis serovar A Deubiquitinase and deneddylase Dub1 (cdu1)

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar A Deubiquitinase and deneddylase Dub1 (cdu1)
orb2925046-02 100 µg

Recombinant Chlamydia trachomatis serovar A Deubiquitinase and deneddylase Dub1 (cdu1)

Sign In for Pricing
View Details