Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ZC3H7B protein

This Human ZC3H7B protein spans the amino acid sequence from region 481-915aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rotavirus 'X'-associated non-structural protein

UniProt

Q9UGR2

Expression Region

481-915aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQESKKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAKARHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAHSPEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCDRLQKGKACPDGDKCRCAHGQEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CTNNA3 Protein, His (Fc)-Avi-tagged
CTNNA3-2057M 50 µg

Recombinant Mouse CTNNA3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Ddx59 (NM_001190820) Rat Untagged Clone
RN217010 10 µg

Ddx59 (NM_001190820) Rat Untagged Clone

Sign In for Pricing
View Details
GTPBP2, CT (GTPBP2, GTP-binding protein 2) (Biotin)
MBS6305000-01 0.2 mL

GTPBP2, CT (GTPBP2, GTP-binding protein 2) (Biotin)

Sign In for Pricing
View Details
GTPBP2, CT (GTPBP2, GTP-binding protein 2) (Biotin)
MBS6305000-02 5x 0.2 mL

GTPBP2, CT (GTPBP2, GTP-binding protein 2) (Biotin)

Sign In for Pricing
View Details
MYO1C Knockout NCI-H1299 Polyclonal Cells
ARG17458 1 Million

MYO1C Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Canine BTB/POZ domain-containing protein KCTD3 (KCTD3) ELISA Kit
MBS7227148-01 48 Well

Canine BTB/POZ domain-containing protein KCTD3 (KCTD3) ELISA Kit

Sign In for Pricing
View Details