Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LpxK protein

This lpxK protein spans the amino acid sequence from region 1-328aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lipid A 4'-kinase

UniProt

C4ZQ41

Expression Region

1-328aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIEKIWSGESPLWRLLLPLSWLYGLVSGAIRLCYKLKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRVGVVSRGYGGKAESYPLLLSADTTTAQAGDEPVLIYQRTDAPVAVSPVRSDAVKAILAQHPDVQIIVTDDGLQHYRLARNVEIVVIDGVRRFGNGWWLPAGPMRERAGRLKSVDAVIVNGGVPRSGEIPMHLLPGQAVNLRTGTRCDVAQLEHVVAMAGIGHPPRFFATLKMCGVQPEKCVPLADHQSLNHADVSALVSAGQTLVMTEKDAVKCRAFAEENWWYLPVDAQLSGDEPAKLLTQLTLLASGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pepsin (PGA4) Rabbit Polyclonal Antibody
TA338325 100 µL

Pepsin (PGA4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Grm1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6773406 1.0 µg DNA

Grm1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
IL-6, Recombinant, Human (Interleukin 6, IL6, B Cell Stimulatory Factor 2, BSF-2, BSF2, CTL Differentiation Factor, CDF, HSF, Hybridoma Growth Factor, HGF, Interferon beta 2, IFN-beta-2, IFNB2) discontinued
219957 20 µg

IL-6, Recombinant, Human (Interleukin 6, IL6, B Cell Stimulatory Factor 2, BSF-2, BSF2, CTL Differentiation Factor, CDF, HSF, Hybridoma Growth Factor, HGF, Interferon beta 2, IFN-beta-2, IFNB2) discontinued

Sign In for Pricing
View Details
BOK Human Pre-designed siRNA Set A
HY-RS01570 1 Set

BOK Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
STAR, ID (STAR, STARD1, Steroidogenic acute regulatory protein, mitochondrial, START domain-containing protein 1) (Azide free) (HRP) discontinued
042371-HRP 200 µL

STAR, ID (STAR, STARD1, Steroidogenic acute regulatory protein, mitochondrial, START domain-containing protein 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
FineTest®647 Anti-Human CD3 (OKT-3)
F647-30004-01 20 Tests

FineTest®647 Anti-Human CD3 (OKT-3)

Sign In for Pricing
View Details