Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CspA protein

This cspA protein spans the amino acid sequence from region 2-70aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

7.4 kDa cold shock protein CS7.4

UniProt

P0A9Y5

Expression Region

2-70aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Salmonella enteritidis

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR13D1, CT (OR13D1, Olfactory receptor 13D1, Olfactory receptor OR9-15) (MaxLight 490) discontinued
039323-ML490 100 µL

OR13D1, CT (OR13D1, Olfactory receptor 13D1, Olfactory receptor OR9-15) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Upf3a 3'UTR Luciferase Stable Cell Line
TU222882 1.0 mL

Upf3a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-JUNB Antibody Picoband®, FITC Conjugate
A01825-3-FITC 100 µg/Vial

Anti-JUNB Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycoprotein A33 (GPA33)
MBS2080691-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Glycoprotein A33 (GPA33)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycoprotein A33 (GPA33)
MBS2080691-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Glycoprotein A33 (GPA33)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycoprotein A33 (GPA33)
MBS2080691-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Glycoprotein A33 (GPA33)

Sign In for Pricing
View Details