Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CspA protein

This cspA protein spans the amino acid sequence from region 2-70aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

7.4 kDa cold shock protein CS7.4

UniProt

P0A9Y5

Expression Region

2-70aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Salmonella enteritidis

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEDD9 Antibody
orb53439-01 50 µg

NEDD9 Antibody

Sign In for Pricing
View Details
NEDD9 Antibody
orb53439-02 100 µg

NEDD9 Antibody

Sign In for Pricing
View Details
TNIK, phosphorylated (Ser764) (TRAF2 and NCK-interacting Kinase, KIAA0551) (Biotin) discontinued
T8172-05A-Biotin 200 µL

TNIK, phosphorylated (Ser764) (TRAF2 and NCK-interacting Kinase, KIAA0551) (Biotin) discontinued

Sign In for Pricing
View Details
OBSCN polyclonal antibody
orb1719273-01 50 µL

OBSCN polyclonal antibody

Sign In for Pricing
View Details
OBSCN polyclonal antibody
orb1719273-02 100 µL

OBSCN polyclonal antibody

Sign In for Pricing
View Details
TNNI3K Antibody
orb2673398-01 50 µL

TNNI3K Antibody

Sign In for Pricing
View Details