Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IbpA protein

This ibpA protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

16 kDa heat shock protein A

UniProt

Q1CD74

Expression Region

1-137aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Yersinia pestis bv. Antiqua (strain Nepal516)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRNSDLAPLYRSAIGFDRLFNLLESGQNQSNGGYPPYNVELVDENNYRIAIAVAGFAEQELEITTQDNLLIVRGSHANEPAQRTYLYQGIAERNFERKFQLAEHIKIKGANLVNGLLYIDLERLVPESLKPRRIEIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human CSF2RB pAb
PA5103-01 50 μL

Rabbit Anti-Human CSF2RB pAb

Sign In for Pricing
View Details
Rabbit Anti-Human CSF2RB pAb
PA5103-02 100 μL

Rabbit Anti-Human CSF2RB pAb

Sign In for Pricing
View Details
RAE1 (mRNA Export Factor, Rae1 Protein Homolog, mRNA-associated Protein mrnp 41, MRNP41, MNRP41, MIG14) (AP)
MBS6448857-01 0.1 mL

RAE1 (mRNA Export Factor, Rae1 Protein Homolog, mRNA-associated Protein mrnp 41, MRNP41, MNRP41, MIG14) (AP)

Sign In for Pricing
View Details
RAE1 (mRNA Export Factor, Rae1 Protein Homolog, mRNA-associated Protein mrnp 41, MRNP41, MNRP41, MIG14) (AP)
MBS6448857-02 5x 0.1 mL

RAE1 (mRNA Export Factor, Rae1 Protein Homolog, mRNA-associated Protein mrnp 41, MRNP41, MNRP41, MIG14) (AP)

Sign In for Pricing
View Details
Lactoferrin Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62893R-PerCP-Cy5.5 100 µL

Lactoferrin Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Psmc5 (NM_031149) Rat Tagged ORF Clone Lentiviral Particle
RR205898L4V 200 µL

Psmc5 (NM_031149) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details