Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Influenza A virus Matrix protein 1 protein

This Influenza A virus Matrix protein 1 protein spans the amino acid sequence from region 133-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A2I8BGF8

Expression Region

133-252aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Influenza A virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQRFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf82 Protein Vector (Human) (pPM-C-HA)
PV049971 500 ng

C2orf82 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DCAF8L2 CRISPR Knock Out 293T Cell Line (Human)
17713141 1x 10^6 Cells / 1.0 mL

DCAF8L2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Acetyl-11-Keto-β-Boswellic Acid
RG-A261213-01 10 mg

Acetyl-11-Keto-β-Boswellic Acid

Sign In for Pricing
View Details
Acetyl-11-Keto-β-Boswellic Acid
RG-A261213-02 25 mg

Acetyl-11-Keto-β-Boswellic Acid

Sign In for Pricing
View Details
Acetyl-11-Keto-β-Boswellic Acid
RG-A261213-03 50 mg

Acetyl-11-Keto-β-Boswellic Acid

Sign In for Pricing
View Details
Acetyl-11-Keto-β-Boswellic Acid
RG-A261213-04 100 mg

Acetyl-11-Keto-β-Boswellic Acid

Sign In for Pricing
View Details